Browse matrices

Showing page 2/13: Entry 26 - 50 of 307
Accession Name Consensus Sequence Organism
MX000048 GltC
ATCTMAAWWHKAKAT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000049 GltR
ATYYMAAAWTMAGAT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000050 Hpr
NWHDNTATHWWDVWANHWH
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000051 IolR
TTGCATAAGVTHDTTAHBBDDGTADTHATTADTCAVBAAATADTBAAAAAGTADTGDTTTTTDHDTGAHATTTTTGT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000052 LevR
AMSTGTWTYAAMA
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000053 LicT
GGTYTKKYMYKSWTWMNSMRKVMMARWCC
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000054 MntR
WAWTTTGCMTKARGGAAACT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000055 Mta
GACYMTMMSSTWRSVDKAKDBY
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000056 MtrB
CTMASYYYWWYKWWWYYMWWWCTMTGCTMYCCTMTKCTMWRMYTYWWSYCMTYCWA
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000057 PhoP
KNNNNNHWWYHNWNWWNNWNNNWWNNNANNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000058 PucR
WWWMNYNRNNW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000059 PurR (20-mer)
NNWWAWNMCGAAYATTANNW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000061 PyrR
YTTKDAARSRDTMYRRAGA
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000062 RocR
WMCGCAAAWTWATTTTGCRTT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000063 SenS
MWKKYTYWKRTYRWWTRSWYM
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000064 SigB (-35 region)
NNNGTTTNNNNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000065 SigD
BTHSWSDRRANSVDMDMHKNDWWSWDYMKMWWVAWDVDDDDMN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000066 SigE (-35 region)
WNKMATRNNYN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000067 SigE (-10 region)
NNCATANNNTNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000068 SigE (37-mer)
WNWNKMMTANWYNNNNNNNNYNNNNMATANRNTNWNM
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000069 SigE (36-mer)
NKWKDMATRDHKDHWSVNBMHBHKCATAHDBTWDWR
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000070 SigE (38-mer)
DDRNHHTRYNYDNVBVWBRHVBDBBMHTAYHWBHMKH
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000071 SigB (-10 region)
NNRGGWANNNNW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000072 SigB (33-mer)
NDNGTTTWNNRDDNNNNNDNWNHNKGGWAWNND
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000073 SigB (32-mer)
MNNGWTTNNNNNNNNDNNNNNNNRGGWANWNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.