Browse matrices

Showing page 3/13: Entry 51 - 75 of 307
Accession Name Consensus Sequence Organism
MX000074 SigB (31-mer)
SRSGTTTWNYWYWWTMNMWWKSRGGAAKRRW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000075 SigB (30-mer)
DHHGTWTVDMTHWBTHBMKNHVGGMARDWK
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000076 SigH (-35 region)
RNAGGADWTNNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000077 SigH (-10 region)
RNMGAATNNW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000078 SigL
TDDWWWMVVYWMRMRHHMHKRWDWTGGCAYRRWHCTTGCATTWWWWWWVRDDK
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000079 SigW (32-mer)
NWTGAAACNTWTYKNNNWNYNNNHCGTAWWMN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000080 SigW (-35 region)
DNNTGAAACNTK
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000081 SigW (-10 region)
NNNCGTAWWN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000082 SigW (33-mer)
HDBRAAACWWHTKHHHRKDHHHWKNCGTCTWVB
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000083 SigX (-35 region)
WNYGWAACNWWW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000084 SigX (-10 region)
MNNCGWCWAWNN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000085 SigX (33-mer)
NNKGAAACNWNYNNHNMNNNWNMKNCGTCWANN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000086 SinR
GTTYTSWCGRAWGYAMACRY
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000087 TreR
SYTGTATATACARG
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000088 Xre
KWWWHGATAMAWWHWGTATCRDM
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000089 XylR
RWTTGTTKADMMAAYAAACTAAY
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000090 Zur
AAATCGTWATCATTYTRWT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000112 PurR (50-mer)
MWWWWWNMCGAAYRTTWNNWNWNWYWKWNYWWNWAWYRTTCGNWTTTHRN
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000113 PurR (51-mer)
DRWWAAWMCGAAYAWTAWTWWHKKDDWWWTVWWWWWWMGTTCGBWWYYDDW
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000167 DegU (N11)
ANAANNNNWNNNNNWTTCAG
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000168 DegU (N12)
AGAAACAGATAGATTTTTTAG
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000176 YdiH
TTTGTGAADTABTGAKCAAWDT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000193 KdgR
TTTGAAACCGWTWYCAAA
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000194 SigI
TTGAAGCGTTTTCAT
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.
MX000195 YsiA
ATGAATGASTRTTCAKTCAH
Bacillus subtilis subsp. subtilis str. 168 chromosome, complete genome.